Strip And Sealing Floors

Reliable Strip and Sealing Floors Services In
Wichita KS
Wichita Cleaning Company

Looking for Strip and Sealing Floors Services around WICHITA KS ? If the hard floors of your premises have seen better days, Domain Facility Services can provide assistance with our floor strip and seal services. Floor care is the core of our company. We offer a wide range of services such as floor cleaning, floor stripping and waxing, floor sealing and waxing, floor waxing. We are the floor care professionals that offer the best strip & seal, floor restoration, deep clean and floor maintenance procedures across the NM. Call us for Best Strip and Sealing Floors.

STRIP AND SEALING FLOORS WICHITA KS

Vinyl flooring requires periodic maintenance just like a carpet needs cleaning a vinyl floor will need a deep clean or a strip and seal. It is good practice that hard floor maintenance is carried out on a planned basis; this will protect the top surface from becoming scratched and worn.


A strip & seal involves using a safe stripping agent to remove all of the ingrained dirt from within the tile surface including any bevel edges and textured or embossed surface. Once the vinyl has been thoroughly deep cleaned and stripped back removing all contaminants and residues, it is important to neutralize and rinse the floor allowing it to dry fully before applying any protective coating.


When applying protective dressings and sealants they should be applied in thin coats rather than thick coats, this will enable quicker drying times and a more natural appearance once 3-4 coats have been applied.


If a more permanent sealant is applied such as a PU sealer typically 2-3 coats are applied, this will protect your vinyl floor for a much longer period of time against scratches and loss of appearance. The cost is generally higher for these types of permanent sealing products; they will prevent frequent strip & seal procedures and will only require deep cleaning on a periodic basis which results in lower maintenance costs.

 

 

As a professional hard floor maintenance company, we are familiar with carrying out strip & seals, deep cleans and maintenance clean in a variety of installations from multi-site retail, stadiums, industrial, offices, breakout areas, shopping centers, car showrooms, healthcare centers, hospitals, residential property and more.


If you require hard floor cleaning, strip & sealing, deep cleaning or floor maintenance services, contact us for our professional advice and a no obligation quotation.


Vinyl floors can lose their sheen and brightness over time. This is due to sealer layers getting worn from footfall and daily use. We possess high-end stripping and sealing machines that can remove the older layers and then provide a reapplication with newer more modern sealers to give your floor a stunning finish.


Large floor surfaces that are vinyl coated need to be renewed when they start to lose their luster. We have the right tools to complete the stripping of large surface areas quickly and cost effectively.


We have a range of different sealer products available to ensure we provide you with the toughest and longest lasting seal coat that is the best fit for your type of flooring.
To get a beautiful shine on quality flooring you need to enlist the skills of an expert company that has extensive experience in stripping and sealing both commercial and home environments.


Are You Ready for the Best Strip and Sealing Floors Service Services in the Wichita Area?

Wichita Cleaning Company is waiting for your call, always ready to help you treat your place as you would treat yourself when you want to relax.

CALL US FOR:

SERVICE AREA

  • Andale, KS Strip and Sealing Floors Services near me
  • Andover, KS Strip and Sealing Floors Services near me
  • Argonia, KS Strip and Sealing Floors Services near me
  • Augusta, KS Strip and Sealing Floors Services near me
  • Belle Plaine, KS Strip and Sealing Floors Services near me
  • Bentley, KS Strip and Sealing Floors Services near me
  • Benton, KS Strip and Sealing Floors Services near me
  • Buhler, KS Strip and Sealing Floors Services near me
  • Burns, KS Strip and Sealing Floors Services near me
  • Burrton, KS Strip and Sealing Floors Services near me
  • Cheney, KS Strip and Sealing Floors Services near me
  • Clearwater, KS Strip and Sealing Floors Services near me
  • Colwich, KS Strip and Sealing Floors Services near me
  • Conway Springs, KS Strip and Sealing Floors Services near me
  • Danville, KS Strip and Sealing Floors Services near me
  • Derby, KS Strip and Sealing Floors Services near me
  • Douglass, KS Strip and Sealing Floors Services near me
  • Elbing, KS Strip and Sealing Floors Services near me
  • Garden Plain, KS Strip and Sealing Floors Services near me
  • Goddard, KS Strip and Sealing Floors Services near me
  • Greenwich, KS Strip and Sealing Floors Services near me
  • Halstead, KS Strip and Sealing Floors Services near me
  • Harper, KS Strip and Sealing Floors Services near me
  • Haven, KS Strip and Sealing Floors Services near me
  • Haysville, KS Strip and Sealing Floors Services near me
  • Hesston, KS Strip and Sealing Floors Services near me
  • Hutchinson, KS Strip and Sealing Floors Services near me
  • Kechi, KS Strip and Sealing Floors Services near me
  • Maize, KS Strip and Sealing Floors Services near me
  • Mayfield, KS Strip and Sealing Floors Services near me
  • Mcconnell AFB, KS Strip and Sealing Floors Services near me
  • Milan, KS Strip and Sealing Floors Services near me
  • Milton, KS Strip and Sealing Floors Services near me
  • Mount Hope, KS Strip and Sealing Floors Services near me
  • Mulvane, KS Strip and Sealing Floors Services near me
  • Murdock, KS Strip and Sealing Floors Services near me
  • Newton, KS Strip and Sealing Floors Services near me
  • North Newton, KS Strip and Sealing Floors Services near me
  • Norwich, KS Strip and Sealing Floors Services near me
  • Peck, KS Strip and Sealing Floors Services near me
  • Potwin, KS Strip and Sealing Floors Services near me
  • Pretty Prairie, KS Strip and Sealing Floors Services near me
  • Rock, KS Strip and Sealing Floors Services near me
  • Rose Hill, KS Strip and Sealing Floors Services near me
  • Sedgwick, KS Strip and Sealing Floors Services near me
  • South Hutchinson, KS Strip and Sealing Floors Services near me
  • Towanda, KS Strip and Sealing Floors Services near me
  • Udall, KS Strip and Sealing Floors Services near me
  • Valley Center, KS Strip and Sealing Floors Services near me
  • Viola, KS Strip and Sealing Floors Services near me
  • Walton, KS Strip and Sealing Floors Services near me
  • Wellington, KS Strip and Sealing Floors Services near me
  • Whitewater, KS Strip and Sealing Floors Services near me
  • Winfield, KS Strip and Sealing Floors Services near me
  • Yoder, KS Strip and Sealing Floors Services near me

Contact Details

Wichita Cleaning Company

Best commercial residential cleaning company in Wichita KS

 

Location: Wichita KS

Monday-Sunday 7 am- 11 pm

bestcleaningserviceswichita.com/

handymanserviceswichitakansas.com/

junkremovalhaulerwichita.org/

About Us

Wichita Cleaning Company is a locally owned and operated commercial residential cleaning company servicing all of Wichita and its surrounding cities. We cover most of KS. We partner with a wide variety of customers from local cleaning companies to local Wichita businesses. We have built our business model on superior customer service, matched with excellent professional services. Available 24 hours a day, 7 days a week. Call us for Janitorial Services, Commercial Cleaning, Floor Care, Window Cleaning, Post Construction Cleaning, Office Cleaning, Final Cleaning, Move Out Cleaning services and Airbnb Cleaning. We are flexible enough to accommodate any cleaning schedule or frequency you need. Let us be the last cleaning company you have to call!

  • Commercial Properties
  • Residential Properties
  • Construction Sites
  • Industrial
  • Medical
  • Educational
  • Government Offices
  • Religious Centers
  • Retail
  • Restaurants
  • Post-Construction Cleaning
  • High Rise Communities

Services

  • Commercial Cleaning
  • House Cleaning
  • Residential Cleaning
  • Janitorial Services
  • Pressure Washing
  • Window Cleaning
  • Make-ready Services
  • Floor Care
  • Carpet Cleaning
  • Day Porters & Maids
  • Post-Construction Cleaning
  • Final Cleaning
  • Mover Out Cleaning
  • Office Cleaning
  • Handyman
  • Junk Removal
  • House Clean Out
  • Foreclosure Clean Out

Our sister companies near Wichita KS

WICHITA CLEANING COMPANY
(316) 500-7551
bestcleaningserviceswichita.com

WICHITA HOUSEHOLD SERVICES
(316) 448-3558
wichitahouseholdservices.com

WICHITA BEST CLEANING SERVICES
(316) 500-7551
wichitabestcleaningservices.com

A1 CLEANING OF WICHITA
(316) 500-7551
a1cleaningofwichita.com

PRICE CLEANING SERVICES OF WICHITA
(316) 500-7551
cleaningcompanywichita.com

UNO CLEANING WICHITA
(316) 500-7551
unocleaningwichita.com

MAID SERVICES OF WICHITA
(316) 500-7551
maidservicesofwichita.com

HOUSEKEEPING SERVICES OF WICHITA
(316) 500-7551
housekeepingservicesofwichita.com

CLEANING SERVICES OF WICHITA
(316) 500-7551
cleaningservicesofwichita.com

OFFICE CLEANING SERVICES OF WICHITA
(316) 500-7551
officecleanerswichita.com

WICHITA COMMERCIAL CLEANING
(316) 500-7551
commercialcleaningwichita.org

JANITORIAL SERVICES OF WICHITA
(316) 500-7551
janitorialservicesofwichita.com

Service Area

55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS
Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS
Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS
Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS
Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS
Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS
Winfield, KS | Yoder, KS

ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven

BEST STRIP AND SEALING FLOORS SERVICE SERVICES NEAR WICHITA KS

WICHITA CLEANING COMPANY

REQUEST MORE INFORMATION. CONTACT US