Services

Commercial Residential Cleaning Janitorial Services Wichita KS
Wichita Cleaning Company

Looking for janitorial services near Wichita KS? Contact Wichita Cleaning Company for commercial cleaning janitorial services. We provide business cleaning services for a wide variety of industries in the Wichita area and we also offer residential cleaning services. Wichita Cleaning Company offers top-notch commercial business cleaning services to the Wichita KS area. We strongly believe that you never get a second chance to make a good, first impression.

JANITORIAL SERVICES WICHITA

You come home or return to your office and you are greeted by clean scents, freshly vacuumed carpets, shining countertops, dust-free tables, clean sinks, gleaming bathrooms. This is the reason you want to have a housekeeper, maid, cleaning lady, cleaning service. Your cleaning and housework have been done for you.

Whether you don’t have time to keep your home organized and clean, you truly can’t stand house cleaning, or you just want someone to help you keep up with all of the housework, a well chosen and well managed housekeeper can simplify your life.

  • Top to bottom Detail Cleaning (spring Cleaning)
  • General Cleaning (weekly, Biweekly, Monthly)
  • Move In & out Cleaning
  • Holiday, party prep/ clean up
  • Vacation rentals
  • Apartments
  • Property Management

Since no two homes are alike, we customize our house cleaning service to meet your needs. Wichita Cleaning Company offers numerous services for our residential clients. We have a cleaning solution for all budgets.

Each appointment is unique and valued accordingly. Whether you would like us to do an spring cleaning, or to pick up after a long week, re-organize the garage, customize the pantry, or dust, we handle each task professionally. We are here to accommodate all your cleaning needs. Please call our offices today to reserve your professional cleaning team.

RESIDENTIAL CLEANING IN WICHITA

What are you doing this weekend? Did you have big plans but cancelled them at the last second once you took a look around your home and realized that you can’t put off cleaning up any longer? You shouldn’t have to choose between having a good time with your free time and having a clean home to relax in. At least, that’s how we felt when we started Wichita Cleaning Company many, many years ago and it’s what we continue to preach whenever someone is considering acquiring our residential cleaning services.

If you are tired of being left to pick and choose between having fun and having a clean home, get in touch with Wichita Cleaning Company today. Our thorough, reliable and professional cleaners have received extensive training to make sure that they apply the proper techniques to make your home more sanitary, hygienic and healthy than ever before. Meeting your expectations isn’t good enough for our team, we aim to exceed them.

To get a free quote on our expert residential cleaning services, contact Wichita Cleaning Company today.

If you’re in need of house cleaning and maid services, please visit our house cleaning website:

Cleaning That Works for Your Schedule

One of the biggest reasons people in the area pursue our residential cleaning services is because they don’t have time to provide their homes with the thorough, sanitizing cleans they require to improve their home’s esthetics, indoor air quality and overall health. Without our thorough domestic cleaning services, things like your counters, doorknobs and floors could be breeding grounds for bacteria. Getting sick and having your life derailed by illness shouldn’t be a result of there only being 24 hours in a day.

COMMERCIAL CLEANING IN WICHITA

If your place of business is going to function at maximum efficiency, it needs to be clean. People function better when they are in a clean and organized environment. Plus, when clients and customers see the attention to detail you have put in to maintaining the cleanliness and hygiene of your facilities are bound to impress them and reflect positively on your business overall. Of course, to reap all the benefits that comes with a clean workplace, you need to have dedicated professionals keeping a watchful over your business’s conditions. You could go the route of adding a commercial cleaner in-house, but between their salary, benefits and the added bureaucratic work that comes with adding an employee it isn’t worth it when you can just acquire Wichita Cleaning Company’ commercial cleaning services.

We have been proud to service all kinds of businesses in the area and make sure they are presentable for virtually any situation. Whether you need your carpets cleaned, windows washed or surfaces disinfected, Wichita Cleaning Company’ commercial cleaning professionals can complete whatever tasks your business needs completing to be at its best. Just give us a call today and we’ll be happy to provide you a free quote on our commercial cleaning services.

When you choose Wichita Cleaning Company as your commercial cleaner, remember that we don’t just physically clean your place of work, we maintain your organization’s image. We can clean your commercial space including offices, banks, healthcare facilities, warehouses, industrial spaces, shopping centers and more. Basically, if there is business or commerce conducted somewhere in the area, we will provide it with exceptionally thorough cleaning services—so call us today.

Benefits of Commercial Cleaning Services

If your office or retail space has begun to feel like your second home, you shouldn’t have to worry about keeping your second home clean as well as your actual home. Even if it looks habitable at first glance, investing in a commercial cleaning service is always a great idea because it can help with:

Workplace Safety

Offices, schools and healthcare facilities are breeding grounds for bacteria. Manufacturing facilities are more hazardous when they are untidy. Though you may clean up messes when they are front and center, no one is more effective at cleaning a workplace than Wichita Cleaning Company’ professional cleaners. The average business loses over $1,600 a year to workplace absenteeism caused by personal illness or injury, so rather than lose it, invest that in commercial cleaning services.

Higher Productivity

There have been many studies done that prove a cleaner workplace leads to happier, more productive workers. If you have noticed your staff starting to slouch, the most effective fix might be as simple as getting our cleaners to brighten up the place.

Higher Quality Clean

When you leave the cleaning duties to the professionals, you can rest assured knowing they are doing the best possible job. No one cleans your teeth better than your dentist because that’s their profession. Same logic applies to professional cleaners.

Contact Us Today

To start enjoying a cleaner workplace, contact Wichita Cleaning Company today.

 

CALL US FOR:

OFFICE BUILDING CLEANING WICHITA

Top Rated Wichita Cleaners for Regular Office Cleaning

Wichita Cleaning Company is excessively detail-orientated when it comes to your office cleaning. When you hire Wichita Cleaning Company, you’re hiring a team of dedicated professionals and not just subscribing to a service.

We take pride in being forward thinking and routinely look for ways to go above and beyond what it is typically included in an office cleaning service. Regular office cleaning is more than just protecting your image. It’s about protecting your bottom line.

List of Office Cleaning Services

  • Carpets
  • Bathrooms
  • Trash Removal
  • Vacuuming
  • Detail Dusting
  • Changing Lights
  • Breakrooms
  • Kitchens
  • Much More

MEDICAL OFFICE CLEANING WICHITA

Medical Facility Cleaning for Dentists,

Clinics and Animal Hospitals

Rest assured that your medical facility is always clean and sanitary for your patients. We take health and cleanliness very seriously and understand that this is something that your patients expect when visiting your facility.

Our medical office cleaning involves many standard services including sweeping and mopping floors, trash removal and disinfecting sinks and other surfaces. It is a priority for Wichita Cleaning Company medical cleaning services to create a sanitary and healthy environment for your patients. We take extra care to avoid cross contamination and use the safest, most reliable anti-bacterial cleaners.

Contact Details

Wichita Cleaning Company

Best commercial residential cleaning company in Wichita KS

 

Location: Wichita KS

Monday-Sunday 7 am- 11 pm

bestcleaningserviceswichita.com/

handymanserviceswichitakansas.com/

junkremovalhaulerwichita.org/

About Us

Wichita Cleaning Company is a locally owned and operated commercial residential cleaning company servicing all of Wichita and its surrounding cities. We cover most of KS. We partner with a wide variety of customers from local cleaning companies to local Wichita businesses. We have built our business model on superior customer service, matched with excellent professional services. Available 24 hours a day, 7 days a week. Call us for Janitorial Services, Commercial Cleaning, Floor Care, Window Cleaning, Post Construction Cleaning, Office Cleaning, Final Cleaning, Move Out Cleaning services and Airbnb Cleaning. We are flexible enough to accommodate any cleaning schedule or frequency you need. Let us be the last cleaning company you have to call!

  • Commercial Properties
  • Residential Properties
  • Construction Sites
  • Industrial
  • Medical
  • Educational
  • Government Offices
  • Religious Centers
  • Retail
  • Restaurants
  • Post-Construction Cleaning
  • High Rise Communities

Services

  • Commercial Cleaning
  • House Cleaning
  • Residential Cleaning
  • Janitorial Services
  • Pressure Washing
  • Window Cleaning
  • Make-ready Services
  • Floor Care
  • Carpet Cleaning
  • Day Porters & Maids
  • Post-Construction Cleaning
  • Final Cleaning
  • Mover Out Cleaning
  • Office Cleaning
  • Handyman
  • Junk Removal
  • House Clean Out
  • Foreclosure Clean Out

Our sister companies near Wichita KS

WICHITA CLEANING COMPANY
(316) 500-7551
bestcleaningserviceswichita.com

WICHITA HOUSEHOLD SERVICES
(316) 448-3558
wichitahouseholdservices.com

WICHITA BEST CLEANING SERVICES
(316) 500-7551
wichitabestcleaningservices.com

A1 CLEANING OF WICHITA
(316) 500-7551
a1cleaningofwichita.com

PRICE CLEANING SERVICES OF WICHITA
(316) 500-7551
cleaningcompanywichita.com

UNO CLEANING WICHITA
(316) 500-7551
unocleaningwichita.com

MAID SERVICES OF WICHITA
(316) 500-7551
maidservicesofwichita.com

HOUSEKEEPING SERVICES OF WICHITA
(316) 500-7551
housekeepingservicesofwichita.com

CLEANING SERVICES OF WICHITA
(316) 500-7551
cleaningservicesofwichita.com

OFFICE CLEANING SERVICES OF WICHITA
(316) 500-7551
officecleanerswichita.com

WICHITA COMMERCIAL CLEANING
(316) 500-7551
commercialcleaningwichita.org

JANITORIAL SERVICES OF WICHITA
(316) 500-7551
janitorialservicesofwichita.com

Service Area

55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS
Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS
Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS
Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS
Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS
Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS
Winfield, KS | Yoder, KS

ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven

We can provide medical office cleaning services for any number of medical facilities including dental offices, health clinics and veterinary hospitals.

List of Medical Cleaning Services

  • Cleaning Sinks
  • Lime Deposit Removal
  • Floors
  • Disinfecting Surfaces
  • Bathrooms
  • Trash Removal
  • Changing Lights

SCHOOL AND DAYCARE CLEANING WICHITA

Janitorial Cleaning Services for

Wichita Schools and Daycares

Children deserve a clean environment in which to learn and play, and Wichita Cleaning Company can provide you with exceptional daycare and school cleaning services. We take extra care to use non-corrosive, non-damaging, safe cleaners, which are especially important in rooms where children eat and play.

Children can also leave quite a trail of dirt, crumbs and stains. We’ll safely remove ground-in food and stains from carpets and sanitize tables, toys and play areas.

Wichita Cleaning Company is happy to provide janitorial services for your school or daycare that leave a sanitary, safe environment where kids can be kids.

List of School and Daycare Cleaning Services

  • Carpets
  • Bathrooms
  • Trash Removal
  • Food/Biological Stain Removal
  • Disinfecting Surfaces/Tables/Toys
  • Vacuuming
  • Detail Dusting
  • Changing Lights
  • Kitchens

Much More

RETAIL STORE CLEANING WICHITA

Reliable Retail Cleaning Company in Wichita, NM

You’ll never get a second chance at a first impression. It’s an old saying but true. Your customers will decide within seconds if they want to shop with you, and a big part of that is the cleanliness of your store. Wichita Cleaning Company offers retail cleaning services to help your customers’ first impression be the best it can be.

We understand that your customers are your most valuable asset, and you don’t want to lose them because of a dirty store. Our retail cleaning services provide all of the basics including vacuuming, dusting, sweeping, mopping, trash removal and much, much more.

List of Retail Cleaning Services

  • Carpets
  • Bathrooms
  • Trash Removal
  • Vacuuming
  • Organizing Supplies
  • Changing Lights
  • Breakrooms
  • Much More

JANITORIAL SERVICES IN WICHITA

Carpet & Upholstery Cleaning Wichita

In order to preserve the life of your carpet, it is recommended that you have your carpets cleaned at least twice a year.

We’ll start with a pre-spray cleaning solution suitable for your carpet type and use our hot water extraction method to loosen and lift dirt, grime, and other pollutants from your carpet. We will even apply a carpet protectant if you so desire.

We take special care when cleaning your office furniture as well. One step we do that others may not is vacuum your furniture before we clean it to remove dirt and dust that will stain or damage your furniture if left on while everything is wet.

The type of upholstered furniture you have will determine which method of cleaning is right for you. Most fabrics and fabric blends can be cleaned via heat extraction. Other fabrics such as leather or leather-like materials will usually need to be hand cleaned using either soap and water or a product made for cleaning your type of office furniture (see your manufacturers tag for more information).

 

Floor Care Wichita

There are many different types of floors out there, so we’ve spent many years researching what products work best for which types of floors. We’ll be happy to provide you with a maintenance schedule so your floors always look like the day they were installed.

During your consultation we will observe and analyze all of your tile and grout concerns. We’re experts in tile and grout composition, cleaning, and odor elimination. As a company, we are eager to explain the causes and the processes involved in producing the finest results possible. We can help you with everything from tile and grout cleaning to stripping and waxing your floors. We’ll keep you informed every step of the way.

Get a fast quote now

 

Janitorial Cleaning Wichita

Whether you just need the trash emptied nightly and your bathrooms and break room cleaned once a week or you need more thorough, frequent cleaning services, we’re happy to help. We’ll customize your program according to your needs and budget.

We provide full janitorial services for offices, schools, even sterile cleaning of medical facilities. We provide monthly invoicing and you’ll never be tied into a lengthy contract.

Get a fast quote now

 

 

Move-in & Move-out Cleaning Wichita

Whether you’re a property manager, realtor, business owner, or you lease your commercial space, Wichita Cleaning Company can help you get your property clean and ready for the next owner or renter.

Let’s face it, moving is stressful enough, why worry about the post move clean when AIMS can do a complete cleaning for you.

Our move-in and move-out cleaning services include wiping the inside of your cupboards, closets, refrigerators, and ovens, we’ll even wipe your window tracks and door frames as well as haul away any trash that was left behind. However, we will not haul away major appliances, building materials, chemicals, landscape, or anything we deem hazardous, immoral, or unethical.

Get a fast quote now

 

Post Renovation Cleaning Wichita

Once your construction and remodeling project has been completed for your business, it can be an overwhelming experience just thinking about all the necessary cleaning. There will no doubt be a lot of dust, much of it airborne, and plenty of debris on your surfaces such as your walls and floors. This can prove to be overwhelming not only to your senses but to your health as well.

Not to worry however, our team of experienced and professional cleaning technicians will have your business back in tip top shape in a jiffy! Our extensive array of advanced cleaning equipment and solutions will eliminate your post renovation dust and debris that’s lingering on your surfaces as well as in your air.

Get a fast quote now

 

 

Sterile Cleaning Wichita

If you own or manage a medical building or clinical facility, you might be struggling to find a commercial cleaning company with sufficient expertise and experience to properly clean the variety of spaces in your building, from communal areas and offices to treatment rooms containing delicate and sensitive equipment.

We understand that your clients rely on your expertise to treat them, and you rely on your commercial cleaning team to keep your clinic and various rooms sterile, fresh and sparkling. However, many commercial cleaning companies use chemical-based cleaning products, which can cause allergic reactions, breathing difficulties among other symptoms. For medical facilities we use only hospital-grade disinfectants and advanced cleaning protocols to help reduce cross-contamination and disease transmission.

Get a fast quote now

 

Window Cleaning Wichita

There is no question, clean windows make an impact on the success of your business. Clients form first impressions quickly, and windows are certainly one of those elements that gets noticed by all. Call Wichita Cleaning Company and enjoy streak-free windows. Crystal clear windows that will let the sun shine through and make a positive impression on all your visitors.

Simply call us to set up a time for us to visually inspect your windows. We’ll provide you with an estimate and if you approve the estimate, we will then schedule your window cleaning.

Get a fast quote now

 

Warehouse Cleaning Wichita

Warehouses are inherently hazardous facilities. From slips and falls to mechanical errors and many more potential injuries, the best way to minimize any accidents is to take the necessary precautions to keep your warehouse is the best possible shape. This means free from clutter and any dirt. To an extent, you can be excused for letting your warehouse’s general cleanliness slide a bit. You need to be preoccupied with the proper storage of goods while making sure that they are getting properly distributed. However, it’s not something you can overlook for very long especially since it’s so easy to call Wichita Cleaning Company and acquire our warehouse cleaning services.

Not only will a call to Wichita Cleaning Company improve your warehouse’s overall health and safety, maintaining a clean warehouse is essential to inspiring confidence in your clients. You may not notice the clutter, debris and dirt piling up because you are in your warehouse on a daily basis, but just because it’s not evident to you doesn’t mean that it won’t be the first thing people see when they come in to your facility.

When you get in touch with Wichita Cleaning Company today, you are taking the first step to making your warehouse a safer, more productive and more attractive place to work in and do business with. We’ll be happy to provide you with a free estimate when you call us today. We pride ourselves on being able to offer the most accurate free estimates in the area since we know budgetary concerns are always a top priority.

What’s Included in Our Warehouse Cleaning Services

When you acquire Wichita Cleaning Company’ expert warehouse cleaning services, we will:

  • Dust ledges, rafters and warehouse walls
  • Use pressure washing equipment for floors
  • Remove floor oil and grease stains
  • Remove paint and other floor stains
  • Reseal floors
  • Clean warehouse offices
  • Clean employee washrooms, eating areas, locker rooms and shower areas
  • Vacuum carpets and deep clean when necessary
  • Remove garbage and debris in an orderly fashion

These are some of the basic tasks our warehouse cleaning services include. But having been in this business for many years, we understand that no two warehouses are alike. Sure, they may look similar at first glance, but they all have different cleaning needs that must be met to make sure efficiency, health and safety are maximized. With this in mind, we are happy to offer completely customizable warehouse cleaning plans. Whether you need special equipment cleaned every couple of months or the disposal of hazardous materials on a nightly basis, our team has the necessary licenses, insurances and bonds to get the job done with confidence.

When you call Wichita Cleaning Company today to receive your free estimate, just let us know about any specific tasks you think you’ll need us to take care of and we will be happy to include it in our estimate. There isn’t a warehouse cleaning task we haven’t tackled in the past so do not hesitate to ask us to mind a specific task.

Contact Us Today

For the best warehouse cleaning services in the area, contact Wichita Cleaning Company today and watch your operation improve thanks to consistent and quality cleans.

 

 

Construction Cleaning Wichita

No matter how big or small your construction project is, it is guaranteed to make a huge mess. There is no way to prevent it, which is unfortunate because it can hurt morale if the mess is allowed to accumulate for both contractor and client alike.

A clean job site is an efficient job site. Think about it, is it easier to work in a clean or cluttered space? Even if you typically work at a desk, keeping your area clean can do wonders for your productivity. Can you imagine the difference it makes when you are putting up drywall, installing cabinets or nailing in shingles? Not to mention, construction is very detail oriented work. When you have a clean job site to navigate, the contractors aren’t losing track of valuable pieces that are necessary for the structural integrity of the finished product.

But whose responsibility is it to keep the job site clean? Is it the contractor’s? Is it the client’s? As far as we’re concerned, it’s our responsibility. For the last several years, Wichita Cleaning Company has been proud to offer construction cleaning services to all sorts of construction projects in the area. From minor renovations to erecting brand-new buildings, our goal is to maintain the cleanliness of any area job site to make sure that productivity, morale, health and safety of clients and contractors aren’t impacted by the mess this type of work can’t help but make.

For a free estimate, no-obligation estimate on our construction cleaning services, please give Wichita Cleaning Company a call today.

Boost Your Contracting Business’s Reputation With our Construction Cleaning Services

While Wichita Cleaning Company’ professional cleaners typically work with clients directly, the benefits our construction cleaning services can bring are particularly useful for contractors in the area. No matter how qualified you are or how many satisfied customers will vouch for your services, general contractors are always on thin ice with home and business owners.

Sometimes, it can feel like clients are looking for a reason to mistrust general contractors and in many cases, it can be determined by how you maintain the job site. Obviously, there are a number of different things that can create messes when you are building or remodeling a commercial or residential property, but when you take measures to make sure the area is spotless at the end of the day or when an important walk-through is coming up.

If you have enough on your plate already trying to keep the project on schedule, let Wichita Cleaning Company’ cleaning professionals mind the construction site’s hygiene on your behalf. When garbage, debris and dust are kept to a minimum, it sends a message of professionalism to your clients.

Our cleaners have been conduction construction cleans for several years and we have plenty of knowledge on how to maximize our efficiency. Productivity, morale, health and safety should all increase when you have Wichita Cleaning Company’ professionals in your corner.

Contact Wichita Cleaning Company Today

Whether you are the property’s owner or a contractor, the area’s best construction cleaning company is at your service. Just give us a call today.

 

Green Cleaning Wichita

Life today is hectic and there is no reason to believe it will that it’s going to slow down any time soon. When life gets busy, one of the first things to fall by the wayside is the cleanliness of your home or business. That’s why it’s so important to make sure you have a professional cleaning service you can count on. Free time is precious and few people want to waste it scrubbing floors and disinfecting services. We at Wichita Cleaning Company have enjoyed a ton of success thanks to our ability to step up in times of need and provide a service that improves the overall health and safety of any given residence or business in the area.

If health and safety are two of your priorities when you are looking for a cleaning company, make sure you choose Wichita Cleaning Company as your cleaning company because we offer premium green cleaning services. Our green cleaning services are just like our regular cleaning services in that you can expect attention to detail and meticulous work, the only difference is that we will only use products and techniques that won’t damage the environment or fill your home or business with toxic chemicals.

Many people are still under the impression that the only way to make sure their home or business is clean means bombarding it with chemicals and letting the toxicity linger in the air. This is no longer the case. Green cleaning products have made leaps and bounds in recent years. Not only have they become increasingly better for the environment, they provide the same disinfection with better all-around health.

 

When you are ready to make the switch to green cleaning, give Wichita Cleaning Company a call.

Specialty Green Cleaning Equipment

Many people are under the impression that a green cleaning service is little more than paying for someone to come to your home and business with a mixture of baking soda and vinegar to spray on the various surfaces. While there are certainly green cleaning services that amount to little more than this, when you choose Wichita Cleaning Company as your green cleaning service provider, you are getting professional cleaners with the latest green cleaning equipment to make your home or business a healthier, more environmentally friendly place.

The vacuums we use in our green cleaning services aren’t normal vacuums. They are HEPA filter vacuums, which means that they what is being put back into the air has been filtered and is clean. We also microfiber cloths to eliminate the chance of cross contamination. They are positively charged so they require less products and provide better cleans by trapping dirt. They are also washed and reused so that they don’t end up gathering dust in the local landfill.

Commercial clients that opt for our green cleaning services can also get their bathrooms stocked with hand towels, toilet paper and tissues with a higher percentage of recycled content to lower your organization’s carbon footprint.

Contact Wichita Cleaning Company Today

Get a free estimate on our residential or commercial green cleaning services when you call Wichita Cleaning Company today.

 

Gym Cleaning Wichita

With all the people that come in and perspire over the communal equipment in your gym, it shouldn’t come as a surprise that gyms and fitness centers are among the most ideal places for bacteria and germs to call home. This is an unfortunate truth because gym members are health-conscious by nature. If they weren’t, they wouldn’t be paying for a membership to use your facilities. As a result, if you aren’t providing your gym with the proper maintenance, then you could be doing serious damage to your bottom line. If your equipment, floors and locker rooms always appear to be in a state of disrepair, it won’t be long before your members defect to the competition.

In the gym business, you don’t get any second chances, especially if the problem was that your gym never felt like a clean place to exercise. It’s your responsibility to project an image of health and wellness. If you fail to do this on a regular basis, then you might be in the wrong business. Of course, even the most passionate gym owners need a little bit of help when it comes to maintaining the level of their cleanliness.

If you want to take extra precaution to make sure your business isn’t going to be affected by unsanitary conditions, give Wichita Cleaning Company a call today. We have been proud to provide area gyms, fitness centers and studios with exceptional cleaning services for many years. We understand that cleanliness is one of the most important factors in a gym’s success.

No one wants to spend a prolonged amount of time in a moist environment where you can practically feel the bacteria growing around you. With our extensively trained and dedicated staff, we can make sure that your facility is disinfected and sterile so that people can work up a sweat without having to worry about contracting a disease of some kind.

Give Wichita Cleaning Company a call today to receive a free quote on our services.

Gym Cleaning Services Include

Our cleaning crews make sure that:

The equipment is disinfected daily. All exercise equipment must be cleaned on a regular basis to make sure that body oils and sweat do not build up on its surfaces.

  • All the floors are mopped daily.
  • Lockers, benches and other locker room assets are wiped down and disinfected daily.
  • The air is circulated so that the atmosphere feels fresh and welcoming.
  • All bathroom areas are disinfected and sanitized.
  • The entrance of your gym is spotless for a good first impression.

These are just a few of the services we will be happy to provide you with when you choose Wichita Cleaning Company as your gym cleaning company. If you have a specific task you would like us to add to your cleaning schedule, just let us know and we will include it.

Contact Wichita Cleaning Company Today

Get a free estimate on our residential or commercial green cleaning services when you call Wichita Cleaning Company today.

 

 

Industrial Cleaning Wichita

A clean work environment promotes health, safety, efficiency and productivity, but it can be difficult to achieve in the industrial sector given how much goes in to the day-to-day operations of manufacturing plants and warehouses. Of course, the best way to make sure the cleanliness of your industrial property does not start to slip is to hire a qualified team of professional janitors to stay on top of it.

If getting a team of certified, trained, licensed and insured professionals on the case sounds like the ideal situation for you, then contact Wichita Cleaning Company today. We have been proud to serve industrial spaces all over the area, helping them prosper into greater successes.

Our high level of expertise will benefit your organization because we take great pride in being able to increase the overall health and safety of your facility. Wichita Cleaning Company can offer the highest level of industrial cleaning services in the area at the most affordable prices, which is why you should call and get your free estimate today.

Types of Industrial Cleaning We Offer

Industrial cleaning is an umbrella term that can mean a lot of different things to several different organizations. With this in mind, we can offer you:

  • High-level cleaning
  • Plant floor cleaning
  • Warehouse cleaning
  • Manufacturing plant cleaning

No matter which type of industrial cleaning you need, you can always expect our team to deliver a high-quality clean at maximum efficiency. Plus, our goal as a company is to always cater to your specific needs. We have been in the industrial cleaning business long enough to know that no two industrial buildings are the same. Some may need us to keep their warehouse clutter free, others will need us to navigate heavy machinery and keep it free from debris. When you call us to get your free estimate, we will go over any specific requests or concerns you have to craft a custom cleaning program that makes sure you are getting the exactly what you need.

Not only will we tailor the specific cleaning tasks we administer to your operation, we can also offer your organization flexible hours to accommodate your needs. Overall, our goal isn’t just to impress you with the quality of our services but our commitment to customer satisfaction as well.

Full-Service Industrial Cleaning Companies

If you have been duped before by a cleaning company that says they can clean your facility only to show up expecting you to supply the necessary tools, you don’t have to worry about that with us. Wichita Cleaning Company is an asset-based cleaning company, meaning we own all our equipment and know how to use it in the most efficient manner.

Contact Us Today

There is no question that even if you are happy with the level of productivity and safety at your industrial facility, it can always be better. If you want to exceed your current ceiling, get in touch with Wichita Cleaning Company today and let us build a partnership that will have you reaping tangible benefits for years to come.

 

Medical Office Cleaning Wichita

All businesses need to keep their facilities clean because cleanliness projects professionalism. When you neglect to provide your employees and clients with a clean environment, regardless of what industry you’re in, you are hurting your business’s reputation. And in no industry is this more detrimental than healthcare.

From the minute a patient walks in to your medical office, they are evaluating the quality of your services with their eyes and noses. Foul smells, scuffs, dust and other signs that you haven’t been providing your medical office with the maintenance it needs to function at peak efficiency is cause for concern. If you can’t provide your medical office with this most basic care, who can say that you can provide them with the best possible care?

Operating an unsanitary medical office, no matter what your practice specializes in, is a surefire way to drive patients away and ruin your reputation. You have come too far to lose it all over the cleanliness of your medical office, which is why you need to make sure this doesn’t happen by getting backed by a team of dedicated and reliable janitorial professionals.

For the best medical office cleaning services in the area at unbeatable prices, get in touch with Wichita Cleaning Company. At Wichita Cleaning Company, we understand that it’s not just the health professional’s reputation at stake when we clean their facilities, it is also patients’ health. There are all kinds of potential for cross-contamination that can lead to serious illness and infection if the area isn’t properly disinfected, which is why we take your office’s hygiene so seriously.

Our custodians are fully certified and trained to clean all types of medical offices, so call Wichita Cleaning Company today to get a free quote on our medical office cleaning services.

Customized Cleaning Services

Every medical office functions in its own unique way. That may because of personnel or the specialization of your practice, but for us, that means we need to be able to adapt our cleaning services in order to meet your facility’s unique needs. There is no sense trying to fit a square peg in a round hole, same goes for trying to sell you on a prepackaged service that doesn’t address little details that can make all the difference. When you call Wichita Cleaning Company today to request your free quote, we will ask you about what it is that you do so that we can already begin formulating how we will approach cleaning your medical office.

No matter what the specific details of your custom cleaning plan are, you have Wichita Cleaning Company’ guarantee to always use the highest-grade disinfectant cleaning products to make sure there isn’t a trace of bacteria posing a threat to the health of your patients or to your practice’s reputation.

Contact Us Today

When choosing a cleaning company to provide medical office cleaning services, you should always go for the company that has extensive experience treating healthcare facilities. Wichita Cleaning Company has helped more healthcare offices than we can count thanks to our reliable and affordable service. So, call us today to get on the program.

 

 

Office Building Cleaning Wichita

No matter goes on at your office from 9 to 5, there is no question that cleanliness is essential. A clean office has so many different benefits for employees, clients and your business’s brand as a whole. But who can you count on to keep your office clean? You don’t want your employees taking time out of their days to sweep, dust and disinfect because they have better things they can do on your dime, like do the job they were hired for. And, unfortunately, you can’t count on them to police themselves to keep the area clean because they all have their own individual standards of cleanliness that may not be up to professional standards.

You can always make room on your staff for a cleaning person. They can stay on top of the office’s cleanliness all day, every day but that can get expensive. Not only will you have to pay them their salary, they may be eligible for insurance and other benefits that could start to affect your bottom line, particularly if there isn’t much cleaning to do besides minor jobs through Monday to Friday.

So, what are you supposed to do to make sure your office space is clean, comfortable and presentable to everyone that passes through your doors? The easy answer is to contact Wichita Cleaning Company to get a free estimate on our professional janitorial services.

We have been proud to offer office building cleaning services at affordable prices for many years. To find out more about what’s included in our office building cleaning services, give us a call today or continue reading below.

Office Cleaning Checklist Wichita

When you choose Wichita Cleaning Company as your office cleaning service provider, we utilize a customizable checklist to make sure that no stone is left unturned. Every office is used differently, which influences how the messes accumulate. To ensure customer satisfaction, we follow your instructions to a tee. The frequency of our services is up to you as are the priorities.

When you choose our office cleaning services, Wichita Cleaning Company’ team of licensed professionals will:

  • Daily Cleanings
  • Empty waste receptacles
  • Vacuum carpets and mats
  • Vacuum hardwood floors
  • Disinfect horizontal surfaces
  • Mop hardwood floors
  • Tidy reception area
  • Wipe all internal glass
  • Stock toilet supplies
  • Clean and polish bathroom mirrors
  • Mop restroom and kitchen floors
  • Monthly Cleanings
  • Vacuum vents and chairs
  • Clean glass inside and out
  • Spray and buff all hardwood floors

Your office building should be cleaned your way. That’s our philosophy and if you agree, give us a call today so that we can get to work devising a plan to effectively and efficiently clean your place of work. Once you have acquired our office building cleaning services, you will never have to worry about your business projecting an unprofessional image ever again.

Contact Us Today

Acquiring Wichita Cleaning Company’ office cleaning services is one of the smartest investments any business can make. Our commitment to thorough, quality cleans is unparalleled, which is why you should give us a call today to find out how much it will cost to have your office cleaned by trained and passionate professionals.

 

Post-Construction Cleaning Wichita

If your home or business has just been built, renovated or remodeled and you think you can walk right in, you are in for a shock. Unless you have hired the world’s most considerate contractors, there is going to be a mess that needs to be taken care of before you can fully settle in. Unfortunately, a post-construction cleanup is rarely as simple as sweeping up the dust, although we can almost guarantee that there is going to be a lot of dust.

Post construction cleanups typically involve a lot of heavy lifting, ladder work and some debris removal. Does that really sound like something you want to worry yourself with ahead of moving in to your space? Most people don’t, which is why we have been proud to offer post-construction cleaning services to home and business owners in the area to make get settled a lot easier.

Wichita Cleaning Company has been proud to offer expert post-construction cleaning services with a licensed staff that make the perfect partners with any type contractor. When our cleaners arrive onsite, they do so fully prepared for whatever the task at hand is with the necessary supplies, equipment and tools that could be needed to ensure that your home or business comes out looking as stunning as possible. We use heavy-duty shop vacs that can suck up all the tiny dust and debris particles from area that would otherwise take countless passes with brooms and mops.

With the help of Wichita Cleaning Company’ professional post-construction cleaning services, there won’t be an inch of your new, renovated or remodeled space that isn’t sparkling. For a free estimate on our exceptional post-construction cleaning services.

Post-Construction Cleanup Checklist Wichita

The most important of any professional cleaning service, particularly a post-construction cleanup service, is to make sure that there are no tasks overlooked. When you choose Wichita Cleaning Company to provide your post-construction cleanups, we work off a thorough checklist to make sure that there are no steps skipped. Some of the things included on our checklist include:

  • Cleaning all dirt, dust and debris
  • Cleaning and sanitizing washrooms, kitchens and appliances
  • Wiping down light fixtures and outlets
  • Cleaning out vents and ductwork
  • Washing windows, removing stickers and residue
  • Vacuuming carpets and steam-cleaning where necessary
  • Washing ceilings and walls
  • Trash removal
  • And so much more.

The best part about our checklist is not that it keeps us on track, but it’s totally customizable. If there are certain areas or things that absolutely need to be addressed immediately, we can reorganize our checklist so that it is in line with exactly what you want.

Post-construction cleanups are all about making sure you are comfortable, so don’t hesitate to tell us how we can do that for you.

Contact Us Today

When construction is complete, make sure that your new residential or commercial space is ready for you when you contact Wichita Cleaning Company today for a free estimate on our post-construction cleaning services.

 

Scheduled Cleaning Wichita

Even though there a few things more important than good hygiene and cleanliness, it’s no secret that it can be a struggle to make time to get the job done right. Sure, you may have time to do the dishes around the house or tidy up around the office, but it’s not enough to get rid of the microbes and bacteria hiding in plain sight? But what can you do? There are only 24 hours in a day. After a long day of work, you can’t be bothered to scrub the floors of your office and come home to dust everything from the baseboards to the light fixtures.

If you have found it increasingly difficult to make time to give your home or business the thorough clean it needs to feel fresh on a regular basis, it might be time to accept that there is no way to fit it in to your busy schedule. Luckily, giving up on trying to make time to clean your home or business doesn’t mean letting it fall into squalor. Instead, you can just leave it to the professionals at Wichita Cleaning Company.

Wichita Cleaning Company is a full-service cleaning company that can improve the overall cleanliness and comfort of your home or business. We can do this by offering scheduled cleaning services that are among the most thorough and reliable in the area. All you have to do is give us a call today and we’ll help you determine the frequency of cleaning plan that works best for your needs. Once we have an idea of what you’ll need, we will provide you with a free estimate of our scheduled cleaning services.

Call us today to have the most reliable scheduled cleaning services in the area taking care of your home or business’s health.

Flexible Scheduled Cleaning Services

One of the reasons Wichita Cleaning Company’ scheduled cleaning services continue to be among the best in the area is not just because they are reliably consistent in the quality of clean and punctuality of their service, but we make our schedules work with yours.

Scheduled cleaning services don’t work if they only work for our hours. That is why all you need to do is let us know what time would be ideal for your home or business and we will find a way to accommodate you. It’s as simple as that! Our primary goal, other than providing our clients with thorough cleans that make their homes or businesses feel as good as new, is customer satisfaction. And we can do this by making sure all your needs are met, including those of convenience.

We can provide you with daily, weekly, bi-weekly or monthly scheduled cleaning services at virtually any time of day, any day of the week. We also offer custom scheduled cleaning services because, once again, our aim is to please.

Contact Us Today

When you are tired of choosing between enjoying your free time and cleaning your home or business, give Wichita Cleaning Company a call and let us know when we can come pick up the slack on your behalf.

 

 

 

School Cleaning Wichita

Any space where children congregate needs to receive special cleaning services in order to properly disinfect the area. Because their immune systems aren’t yet fully developed, it is a lot easier for them to catch some kind of illness from germs and bacteria that linger on the various surfaces they come in contact with throughout the day. With this in mind, it is extremely important for schools in the area to receive the thorough cleans provided by a professional cleaning company so as to minimize the risk of bacteria getting transmitted from child to child.

If your school’s demographics are on the older side, you can’t in good conscience skip out on providing your facilities with the proper maintenance. Just because your student body is a bit older, that doesn’t make them impervious to germs and days lost to illness. Plus, you can’t underestimate the benefits that await from providing your students with a clean environment. Cleanliness has been proven to be part and parcel with better concentration, which will help with the overall effectiveness of your operation.

When you decide it’s time to provide your students and staff with facilities that are properly disinfected at a frequency that works for your budget, give Wichita Cleaning Company a call today. We have been proud to make all types of educational organizations all over the area cleaner, healthier spaces for many years. You’ll be amazed by the difference our cleaning services can make in the overall comfort of your school, so give us a call today so that we can provide you with a free estimate.

Knowledgeable and Experienced School Cleaning Services

Having the necessary knowledge and experience to complete the task at hand is an asset no matter what the nature of the job is. This is especially true when it comes to cleaning schools because there is very often a lot of ground to cover on a tight schedule. Our team has received a ton of training so that they can properly disinfect the more problematic surfaces in an efficient manner. They are also very experienced using state-of-the-art tools and hypoallergenic cleaning products to make sure we are making the most of our time in your school.

Our knowledge and experience that comes from years of cleaning schools around the area also makes it easier for us to adapt our standard cleaning routine for one that meets your exact needs. Our goal isn’t simply to leave every school sparklingly clean, we also want to make sure that our clients have made a smart investment. And we can’t do that if you feel that all your needs are being met. So, whatever special instructions or requests you might have, just let us know and we will be happy to incorporate them into our regimen.

Contact Us Today

With a highly skilled team of professional cleaners making sure that your facility is as clean as can be, you can focus on more important things. To have one less thing to worry about day in and day out, contact Wichita Cleaning Company now.

 

 

 

Shopping Center Mall Grocery Store Cleaning Wichita

Shopping centers aren’t what they used to be. Let’s face the facts, people don’t need to head to the mall or even the corner store when they need something. Everything they could ever want is available online. But that doesn’t mean your operation is obsolete. Shopping centers still have a role to play in our lives. They can still serve as a social outing or a place to congregate and that can never be replaced by online shopping, either to grab a bite to eat, see a movie or just take a walk and window shop.

However, to make your shopping center a destination for friends and families, it needs to be a place they feel comfortable being in. And comfort can be a difficult feeling to evoke if your mall or shopping center isn’t receiving proper maintenance. Whenever a space is dirty, it’s typically the first thing people notice and it more often than not leaves a bad taste in their mouths. Thankfully, it has never been easier to guarantee that your shopping center is as clean as can be.

Wichita Cleaning Company’ shopping center cleaning services have been helping malls and other retail complexes assure their customers of their professionalism for many years. When we are contracted to clean your shopping center in the area, you can focus on more important matters because you will know that your place of business is spotless around the clock.

To make sure that your shopping center is an appealing place to shop, eat or just hang out, then contact Wichita Cleaning Company today to get your free estimate.

Personalized Cleaning

Every facility requires different types of cleaning. This may be because of the flooring you have chosen or simply because of the way your building is designed, but we can’t apply the exact same techniques and procedures that we have for previous clients. That is why we are committed to creating personalized cleaning plans to make sure your specific needs are met. All you need to do is tell us about your mall’s cleaning needs when you give us a call today and we will get started on developing a plan for you that fits your facilities to a tee.

Trained and Insured Staff

It’s not uncommon for shopping center owners and managers to proceed with caution, unsure that we can deliver on our promise that we can deliver such impeccable cleans with so much consistency. We are able to thanks to our staff. Every member of Wichita Cleaning Company’ team has received a ton of training in the most efficient and effective cleaning techniques so that we can get your space cleaner faster. They also have all the necessary insurances so that any accidents or injury that occur while onsite you will not be liable for.

Contact Us Today

Cleaning large facilities like a shopping center requires the use of quality materials, specialized techniques and exceptional time management. And these are the things you will get when you choose Wichita Cleaning Company as your shopping center cleaning provider so give us a call today.

 

 

Spring Fall Summer Cleaning Wichita

When people still relied on coal, oil and wood to heat their homes, these types of fuel would leave homes dusty, dirty and covered in soot. By the time warm weather returned, it was essential that they took the time to remove all the grime created by their heat source and that’s how spring cleaning was born. Nowadays, though we don’t rely on heating systems that create messes throughout our homes, spring cleaning is still an important ritual to observe. After months of short days and colder weather, homes and businesses tend to have accumulated clutter and all kinds of other dirt that needs to go.

Of course, not everyone has the time to for spring cleaning because it’s not as simple as opening up the windows and letting the cool, spring breeze push all the unwanted junk out the front door. When spring has arrived, or even if it’s still around the corner, when your home or business needs a deep clean to rinse away the winter blues, get in touch with Wichita Cleaning Company.

Wichita Cleaning Company has been proud to offer professional spring cleaning services to private residences and commercial properties in the area once the days start getting longer and chores require a little bit more elbow grease to get you ready for the coming season. Our spring cleaning services are very similar to our regular residential and commercial cleaning services, except we go a step further! We make sure that all areas are covered and we’ll dive deeper as per your request.

Start spring on the right foot and gear up for summer with an immaculately clean home or business when you acquire Wichita Cleaning Company’ professional spring cleaning services today.

Deep Cleanings Just in Time for Springtime

Wichita Cleaning Company’ spring cleaning services are deep cleans of homes and businesses in the area. So, what’s included in a deep cleaning? It all depends on your home or business, but here are some examples:

  • Tile grout scrubbed
  • Wastebaskets sanitized
  • Individual knickknacks cleaned
  • Behind the refrigerator cleaned
  • Outside of cabinets washed
  • Inside of microwave cleaned
  • Lamp shades wiped and dusted
  • Ceiling fans dusted and wiped

Our goal is to leave no stone unturned so that your home is spotless. This is especially useful for people who suffer from spring allergies. By making sure there isn’t a trace of dust or other allergens in your home and business, you can finally enjoy this season where everything’s in bloom.

Year-Round Deep Cleans

Though our deep cleaning services are especially popular at the beginning of spring, hence why we refer to them as spring cleaning services, we offer them year-round to make your home and business immaculate whenever you want or need it. You shouldn’t have to wait for a certain time of year to be in a space as clean as can be and with Wichita Cleaning Company’ team of professional cleaners you don’t have to.

Contact Us Today

To get a free quote on our spring cleaning and deep cleaning services, contact Wichita Cleaning Company today and we’ll be happy to give you a breakdown of the costs.

 

Tile and Grout Cleaning Wichita

No matter your tastes, you can’t go wrong with tile flooring. The amount of different styles, colors and textures available is staggering and you are sure to find something that suits your home or business. Plus, it can last up to 50 years and this longevity makes the investment worthwhile. That said, it can be difficult to maintain overtime. When it comes to spot cleaning, tile is one of the easiest materials to tidy up, but like carpet, grime builds up over time and dulls your tile’s appearance and discolors the grout.

Grout is a porous material that can’t be cleaned with regular mopping. The only way to restore your tile and grout to its former glory is to remove the dirt that’s buried deep within the material’s little holes is with a professional clean. So, when you are ready to rejuvenate your home or business’s tiles, give Wichita Cleaning Company a call.

We have been proud to offer the most comprehensive tile and grout cleaning services that make your home and business presentable again. You may not think about it often but a dirty looking floor can deter clients or disgust guests. Stop making the wrong impression on those important people with Wichita Cleaning Company’ help.

Call us today to request a free quote on our expert tile and grout cleaning services.

How We Clean Tile and Grout

There are many different tile and grout cleaning methods we can apply to your home or business. It really depends on the type of tile, the size of the room and where it’s located. We can clean tile and grout on floors, counters and walls, but there are different practices for each.

We will begin the process by conducting a comprehensive inspection just to see the extent of the dirt. Once we have completed the assessment of the tile and grout you need cleaned, we will devise a unique strategy to maximize the effectiveness of our services. From there, all you need to do is sit back, relax and wait to enjoy your good-as-new tiles.

Sealing Tile and Grout

After cleaning your home or business’s grout, we can also apply a sealant to make sure there is an added layer of protection to prevent dirt from entering and causes the deterioration of your tiles. There are many different sealants available on the market today and determining which one will work best for your unique circumstances is essential to maximizing its effectiveness.

As you may have already noticed, Wichita Cleaning Company is big on catering to the specific needs of our clients because that’s the best way to make sure they are satisfied with our services. Next to making tile and grout more beautiful than before, customer satisfaction is our top priority.

Contact Us Today

Trying to clean tile and grout yourself is one of the most difficult chores you’ll ever have to do. The worst part about it is that even after hours of scrubbing, it may not even make much of a difference. Spare yourself the frustration and get in touch with Wichita Cleaning Company’ professionals today.