New Construction Cleaning

Best New Construction Cleaning Post Remodeling Cleaning Services in Wichita KS
Wichita Cleaning Company

Looking for new construction cleaning services in Wichita? Hire Wichita Cleaning Company for best post construction cleaning and post construction cleanup services. Get quotes or book online now. Phone: ! Best post construction clean-up Company in Wichita KS. Cost? Starting from 0.10 cents per sqft. Free estimates! Call today or schedule online easily!

REQUEST A QUOTE NOW!

NEW CONSTRUCTION CLEANING

Wichita Cleaning Company offers the following services for our Valued Construction Customers. We will clean and remove Saw Dust, construction dust and waste. We provide new construction clean up services. Janitorial services are offered once the construction cleaning is complete. We offer buffing, waxing services, customized construction cleaning services in commercial and residential; post-renovation and post-demolition. Available anywhere in the Wichita! Construction and Remodeling Clean-up Service: It is our pleasure to price your construction clean-up project by the square foot or by the job. Our cleaners are trained in the fine art of new construction and remodeling cleaning.

GET MORE INFORMATION ABOUT OUR CONSTRUCTION CLEAN-UP SERVICES – CLICK HERE

HOW MUCH DOES IT COST? FREE ESTIMATES – SEND US A MESSAGE NOW

NEW CONSTRUCTION CLEANING SERVICES – WICHITA KS

The team at Wichita Cleaning Company provides customized construction cleaning services in each of the following categories. These services are available anywhere in the city of Wichita. We can provide green cleaning products, standard products or a customized mix of both to fit your specialized needs. Contact us today for your free bid!

Each of these construction cleaning services may include any of the following tasks depending on your specific requests.

  • All ladders, scaffolding, lifts and specialty equipment required.
  • Clean sills and all components of windows, storefronts, and door glazing.
  • Clean millwork countertops, cabinets, shelving and drawers inside and out.
  • Wipe down interior and exterior doors and door frames.
  • Proper personal protective equipment provided and worn at all times.
  • Clean rubber and wood flooring and wall base per manufacturer’s recommendations.
  • Wipe down wood paneling and trim to be free of dirt, dust, tape residue and fingerprints.
  • Cleaning of exposed interior hard surfaces to be free of dust, grease, stains, films and fingerprints.
  • Clean interior and exterior handrails.
  • Clean interior and exterior glass and frames for all openings.
  • Wipe down door hardware including removal of plastic.
  • Wipe down and dust exposed mechanical and Electronics equipment.
  • Clean faceplates, outlets, switches and receptacle covers.
  • Wipe down piping, ductwork, supports, access panels, cleanout covers, floor drains and sinks.
  • Clean elevators inside and out, including frames, doors, lights and fixtures.

BOOK OUR NEW CONSTRUCTION CLEANING SERVICE NOW

RELIABLE CONSTRUCTION CLEANING POST RENOVATION REMODELING CLEANUP IN WICHITA KS

A clean, fresh facility makes a great first impression on your customers. But a dirty, disorganized site is more than just unprofessional; it’s dangerous. No matter what business you’re in, dusty odors and dingy floors are anything but appealing.

At Wichita Cleaning Company Construction Cleaning in Wichita KS, we provide dependable, high-quality commercial constructions site cleaning services. Our goal is to provide you with a clean, safe environment for your crew and customers. The cleaning professionals at Wichita Cleaning Company Construction Cleaning are carefully trained to provide a meticulous clean at each and every visit. And because your satisfaction is our highest priority, we’re committed to providing nothing less than the very best customer service.

CLICK HERE TO SCHEDULE A NEW CONSTRUCTION CLEANING SERVICE

2018-2019 CONSTRUCTION SITE CLEANING COSTS | PRICE OF CONSTRUCTION SITE CLEANUP SERVICES

The cost per square foot for cleaning a large commercial property will likely be well under the cost per square foot for residential cleanup. While commercial cleanup generally costs between $0.10-$0.30 per square foot, residential cleanup jobs range from $0.10-$0.50 per square foot. Prices for post-construction cleanup vary, of course, but the average price for a residential job is $250-$800. For commercial cleanup, budget anywhere from $0.10 to $0.50 per square foot, depending on the type of cleaning. The cost of a clean-up job can range greatly depending on exactly how large of a project you are dealing with and how much of a mess the construction company leaves. Furthermore, the size of the property can also affect the price you are quoted.

FREQUENTLY ASKED QUESTIONS POST-CONSTRUCTION CLEANING WICHITA

Wichita Cleaning Company Wichita services residential homes and also offers post-construction cleaning in Wichita for newly built homes.

FAQ – POST RENOVATION CLEANING

Where is your office located?

We have an office in Wichita, KS. You can find our address and phone number on our contact page.

What is your general service area?

We service Wichita KS and surrounding cities in 50 miles radius.

Can you give me a quote over the phone?

We strongly urge that if you request an estimate or quote that we send a representative to your location. Every home is different and requires a different level of cleaning services, which our representative will be able to determine upon viewing your home.

Do we have to supply any cleaning products?

No, we come fully supplied to clean your home. You will not need to provide any supplies.

How often will I have my Apartment cleaned?

We tailor our services to your needs and requests. We can provide a one-time cleaning to freshen up your home or if you prefer a scheduled routine, we can service your home on a weekly, bi-weekly, or even on a monthly basis.

What consists of a Wichita Cleaning Company cleaning team?

At Wichita Cleaning Company, we believe the most efficient team consists of two individuals, a team captain and a team member. Under certain circumstances a single or three team members will service you home.

Will the same person clean my Apartment?

For recurring services, we attempt to send the same team to service your home. We want you to recognize and know the team that cleans your home on a routine basis to build a trusting relationship. If a change ever does occur, we will notify you of the changes prior to the appointed service date.

If I have a problem, what can I do?

If you ever have a concern or a complaint, please share them with the team captain. Each of our team captains are friendly and willing to help, as they want to ensure the cleaning services performed are up to your standards. If you wish not to discuss any problems with the team captain, feel free to contact our office to discuss your concerns.

Contact Details

Wichita Cleaning Company

Best commercial residential cleaning company in Wichita KS

 

Location: Wichita KS

Monday-Sunday 7 am- 11 pm

bestcleaningserviceswichita.com/

handymanserviceswichitakansas.com/

junkremovalhaulerwichita.org/

About Us

Wichita Cleaning Company is a locally owned and operated commercial residential cleaning company servicing all of Wichita and its surrounding cities. We cover most of KS. We partner with a wide variety of customers from local cleaning companies to local Wichita businesses. We have built our business model on superior customer service, matched with excellent professional services. Available 24 hours a day, 7 days a week. Call us for Janitorial Services, Commercial Cleaning, Floor Care, Window Cleaning, Post Construction Cleaning, Office Cleaning, Final Cleaning, Move Out Cleaning services and Airbnb Cleaning. We are flexible enough to accommodate any cleaning schedule or frequency you need. Let us be the last cleaning company you have to call!

  • Commercial Properties
  • Residential Properties
  • Construction Sites
  • Industrial
  • Medical
  • Educational
  • Government Offices
  • Religious Centers
  • Retail
  • Restaurants
  • Post-Construction Cleaning
  • High Rise Communities

Services

  • Commercial Cleaning
  • House Cleaning
  • Residential Cleaning
  • Janitorial Services
  • Pressure Washing
  • Window Cleaning
  • Make-ready Services
  • Floor Care
  • Carpet Cleaning
  • Day Porters & Maids
  • Post-Construction Cleaning
  • Final Cleaning
  • Mover Out Cleaning
  • Office Cleaning
  • Handyman
  • Junk Removal
  • House Clean Out
  • Foreclosure Clean Out

Our sister companies near Wichita KS

WICHITA CLEANING COMPANY
(316) 500-7551
bestcleaningserviceswichita.com

WICHITA HOUSEHOLD SERVICES
(316) 448-3558
wichitahouseholdservices.com

WICHITA BEST CLEANING SERVICES
(316) 500-7551
wichitabestcleaningservices.com

A1 CLEANING OF WICHITA
(316) 500-7551
a1cleaningofwichita.com

PRICE CLEANING SERVICES OF WICHITA
(316) 500-7551
cleaningcompanywichita.com

UNO CLEANING WICHITA
(316) 500-7551
unocleaningwichita.com

MAID SERVICES OF WICHITA
(316) 500-7551
maidservicesofwichita.com

HOUSEKEEPING SERVICES OF WICHITA
(316) 500-7551
housekeepingservicesofwichita.com

CLEANING SERVICES OF WICHITA
(316) 500-7551
cleaningservicesofwichita.com

OFFICE CLEANING SERVICES OF WICHITA
(316) 500-7551
officecleanerswichita.com

WICHITA COMMERCIAL CLEANING
(316) 500-7551
commercialcleaningwichita.org

JANITORIAL SERVICES OF WICHITA
(316) 500-7551
janitorialservicesofwichita.com

Service Area

55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS
Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS
Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS
Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS
Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS
Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS
Winfield, KS | Yoder, KS

ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven

SERVICE AREA

  • Andale, KS new construction cleaning services near me
  • Andover, KS new construction cleaning services near me
  • Argonia, KS new construction cleaning services near me
  • Augusta, KS new construction cleaning services near me
  • Belle Plaine, KS new construction cleaning services near me
  • Bentley, KS new construction cleaning services near me
  • Benton, KS new construction cleaning services near me
  • Buhler, KS new construction cleaning services near me
  • Burns, KS new construction cleaning services near me
  • Burrton, KS new construction cleaning services near me
  • Cheney, KS new construction cleaning services near me
  • Clearwater, KS new construction cleaning services near me
  • Colwich, KS new construction cleaning services near me
  • Conway Springs, KS new construction cleaning services near me
  • Danville, KS new construction cleaning services near me
  • Derby, KS new construction cleaning services near me
  • Douglass, KS new construction cleaning services near me
  • Elbing, KS new construction cleaning services near me
  • Garden Plain, KS new construction cleaning services near me
  • Goddard, KS new construction cleaning services near me
  • Greenwich, KS new construction cleaning services near me
  • Halstead, KS new construction cleaning services near me
  • Harper, KS new construction cleaning services near me
  • Haven, KS new construction cleaning services near me
  • Haysville, KS new construction cleaning services near me
  • Hesston, KS new construction cleaning services near me
  • Hutchinson, KS new construction cleaning services near me
  • Kechi, KS new construction cleaning services near me
  • Maize, KS new construction cleaning services near me
  • Mayfield, KS new construction cleaning services near me
  • Mcconnell AFB, KS new construction cleaning services near me
  • Milan, KS new construction cleaning services near me
  • Milton, KS new construction cleaning services near me
  • Mount Hope, KS new construction cleaning services near me
  • Mulvane, KS new construction cleaning services near me
  • Murdock, KS new construction cleaning services near me
  • Newton, KS new construction cleaning services near me
  • North Newton, KS new construction cleaning services near me
  • Norwich, KS new construction cleaning services near me
  • Peck, KS new construction cleaning services near me
  • Potwin, KS new construction cleaning services near me
  • Pretty Prairie, KS new construction cleaning services near me
  • Rock, KS new construction cleaning services near me
  • Rose Hill, KS new construction cleaning services near me
  • Sedgwick, KS new construction cleaning services near me
  • South Hutchinson, KS new construction cleaning services near me
  • Towanda, KS new construction cleaning services near me
  • Udall, KS new construction cleaning services near me
  • Valley Center, KS new construction cleaning services near me
  • Viola, KS new construction cleaning services near me
  • Walton, KS new construction cleaning services near me
  • Wellington, KS new construction cleaning services near me
  • Whitewater, KS new construction cleaning services near me
  • Winfield, KS new construction cleaning services near me
  • Yoder, KS new construction cleaning services near me