Cleaning Service For Pet Owners

Cleaning Service for Pet Owners and cost In
Wichita KS
Wichita Cleaning Company

About our Cleaning Service for Pet Owners near Wichita KS: If you are pet owner and looking for a cleaning service, call Wichita Cleaning Company. Staying on top of cleaning up after your pet is crucial, and also next to impossible; that’s why many pet owners hire a cleaning service like Wichita Cleaning Company. We also offer carpet cleaning, floor cleaning, maids service, deep cleaning and pet urine removal services. Best Apartment cleaning company for pet owners in Wichita KS. Cost of Cleaning Service for Pet Owners? Free estimates! Call today or schedule a Cleaning Service for Pet Owners online easily!

REQUEST A QUOTE TODAY

PROFESSIONAL CLEANING SERVICE FOR PET OWNERS

While many maid services and Apartment cleaning companies balk at the mere mention of pet fur or a litter box, we rejoice in it. We do it all; cat litter box cleaning, pet yard cleanup / pooper scooper services, pet odor removal and more.
 A Apartment that smells of a pet does not necessarily indicate bad Housekeeping on the home owner’s part.  Even the tidiest homemaker can have a stinky pet.  Since dogs and cats spend a lot of time laying and rolling around on the floor, their body odors permeate into the fibers.  Add to that the smell of pet accidents and well… things can get a bit gamey.
With Heaven’s Best arsenal of advanced pet friendly cleaning products and a dedicated team of cleaning experts, we have the tools to tackle any job, big or small.  Stains and odors are removed using an eco-friendly, water-based citrus cleaning solution and an organic deodorizer, ensuring a safe environment for you, your family, and your pets.

 

Pet Urine Removal Wichita Cleaning Company
With the increasing number of pets in American homes, damaged carpet from pet urine is increasingly common.  While pets are great to have, they do require taking some additional care for your carpets to maintain a healthy and bacteria free indoor environment.
Pet urine can cause permanent damage to your floors and fabrics.  When an animal urinates on the carpet it is critical to get the spot cleaned as soon as possible. Urine deposited on carpet does not stay there; it penetrates the fibers and contaminates both the backing of the carpet and the flooring material below the carpet.  Often, without your knowing, pets will urinate continually in the same general location.

 

It is much easier to remove the urine once it has been deposited as the urine is in an acid state.  Once the urine is allowed to dry it becomes alkaline and an array of damage begins to take place.  Your carpet is now the perfect breeding ground for bacteria to flourish almost immediately.  The acid in the urine will react with the carpet and can permanently discolor the carpet, especially if the urine is allowed to sit for days or weeks.

 

Urine, left untreated, will always give off unpleasant and offensive odors.  Urine odors can permeate from the floor whether from a cement slab, wood floor, the tack strips and even behind the walls.  This is caused by the bacteria growth that eventually melds into the carpet fibers and padding.  While the urine may have dried the salt and crystals from the urine remain in and under the carpet.  The slightest moisture, even humidity, will activate these elements making the odor more concentrated and pungent. The only way to get rid of the odor is to remove the urine salts in the carpet, in the backing of the carpet as well as the pad underneath.  In the very worst cases, the concrete slab will need to be disinfected and resealed.

 

How Wichita Cleaning Company works?

 

We will come out to your home and assess the urine stains. If you are unsure as to where the urine spots may be located there is no need to worry.  We can pinpoint where each urine stain is located by using our black light urine detector.  We will start working immediately to remove the urine and salts and restore your healthy indoor environment.  If the damage is extensive, we can pull up the carpet, remove and extract the urine from the affected portions, treating the fibers and the back of the carpet with enzymatic cleaning solution.  Enzyme based cleaning solutions are the only products that will break down the bacteria and ensure a bacteria free healthy home.  In the cases where the acid in the urine has permanently dyed the carpet there is no way to restore the color.  We can, however, re-dye or patch the area with carpet from a remnant or an inconspicuous area such as a closet.

CALL US FOR:

SERVICE AREA

  • Andale, KS Cleaning Service for Pet Owners near me
  • Andover, KS Cleaning Service for Pet Owners near me
  • Argonia, KS Cleaning Service for Pet Owners near me
  • Augusta, KS Cleaning Service for Pet Owners near me
  • Belle Plaine, KS Cleaning Service for Pet Owners near me
  • Bentley, KS Cleaning Service for Pet Owners near me
  • Benton, KS Cleaning Service for Pet Owners near me
  • Buhler, KS Cleaning Service for Pet Owners near me
  • Burns, KS Cleaning Service for Pet Owners near me
  • Burrton, KS Cleaning Service for Pet Owners near me
  • Cheney, KS Cleaning Service for Pet Owners near me
  • Clearwater, KS Cleaning Service for Pet Owners near me
  • Colwich, KS Cleaning Service for Pet Owners near me
  • Conway Springs, KS Cleaning Service for Pet Owners near me
  • Danville, KS Cleaning Service for Pet Owners near me
  • Derby, KS Cleaning Service for Pet Owners near me
  • Douglass, KS Cleaning Service for Pet Owners near me
  • Elbing, KS Cleaning Service for Pet Owners near me
  • Garden Plain, KS Cleaning Service for Pet Owners near me
  • Goddard, KS Cleaning Service for Pet Owners near me
  • Greenwich, KS Cleaning Service for Pet Owners near me
  • Halstead, KS Cleaning Service for Pet Owners near me
  • Harper, KS Cleaning Service for Pet Owners near me
  • Haven, KS Cleaning Service for Pet Owners near me
  • Haysville, KS Cleaning Service for Pet Owners near me
  • Hesston, KS Cleaning Service for Pet Owners near me
  • Hutchinson, KS Cleaning Service for Pet Owners near me
  • Kechi, KS Cleaning Service for Pet Owners near me
  • Maize, KS Cleaning Service for Pet Owners near me
  • Mayfield, KS Cleaning Service for Pet Owners near me
  • Mcconnell AFB, KS Cleaning Service for Pet Owners near me
  • Milan, KS Cleaning Service for Pet Owners near me
  • Milton, KS Cleaning Service for Pet Owners near me
  • Mount Hope, KS Cleaning Service for Pet Owners near me
  • Mulvane, KS Cleaning Service for Pet Owners near me
  • Murdock, KS Cleaning Service for Pet Owners near me
  • Newton, KS Cleaning Service for Pet Owners near me
  • North Newton, KS Cleaning Service for Pet Owners near me
  • Norwich, KS Cleaning Service for Pet Owners near me
  • Peck, KS Cleaning Service for Pet Owners near me
  • Potwin, KS Cleaning Service for Pet Owners near me
  • Pretty Prairie, KS Cleaning Service for Pet Owners near me
  • Rock, KS Cleaning Service for Pet Owners near me
  • Rose Hill, KS Cleaning Service for Pet Owners near me
  • Sedgwick, KS Cleaning Service for Pet Owners near me
  • South Hutchinson, KS Cleaning Service for Pet Owners near me
  • Towanda, KS Cleaning Service for Pet Owners near me
  • Udall, KS Cleaning Service for Pet Owners near me
  • Valley Center, KS Cleaning Service for Pet Owners near me
  • Viola, KS Cleaning Service for Pet Owners near me
  • Walton, KS Cleaning Service for Pet Owners near me
  • Wellington, KS Cleaning Service for Pet Owners near me
  • Whitewater, KS Cleaning Service for Pet Owners near me
  • Winfield, KS Cleaning Service for Pet Owners near me
  • Yoder, KS Cleaning Service for Pet Owners near me

Contact Details

Wichita Cleaning Company

Best commercial residential cleaning company in Wichita KS

 

Location: Wichita KS

Monday-Sunday 7 am- 11 pm

bestcleaningserviceswichita.com/

handymanserviceswichitakansas.com/

junkremovalhaulerwichita.org/

About Us

Wichita Cleaning Company is a locally owned and operated commercial residential cleaning company servicing all of Wichita and its surrounding cities. We cover most of KS. We partner with a wide variety of customers from local cleaning companies to local Wichita businesses. We have built our business model on superior customer service, matched with excellent professional services. Available 24 hours a day, 7 days a week. Call us for Janitorial Services, Commercial Cleaning, Floor Care, Window Cleaning, Post Construction Cleaning, Office Cleaning, Final Cleaning, Move Out Cleaning services and Airbnb Cleaning. We are flexible enough to accommodate any cleaning schedule or frequency you need. Let us be the last cleaning company you have to call!

  • Commercial Properties
  • Residential Properties
  • Construction Sites
  • Industrial
  • Medical
  • Educational
  • Government Offices
  • Religious Centers
  • Retail
  • Restaurants
  • Post-Construction Cleaning
  • High Rise Communities

Services

  • Commercial Cleaning
  • House Cleaning
  • Residential Cleaning
  • Janitorial Services
  • Pressure Washing
  • Window Cleaning
  • Make-ready Services
  • Floor Care
  • Carpet Cleaning
  • Day Porters & Maids
  • Post-Construction Cleaning
  • Final Cleaning
  • Mover Out Cleaning
  • Office Cleaning
  • Handyman
  • Junk Removal
  • House Clean Out
  • Foreclosure Clean Out

Our sister companies near Wichita KS

WICHITA CLEANING COMPANY
(316) 500-7551
bestcleaningserviceswichita.com

WICHITA HOUSEHOLD SERVICES
(316) 448-3558
wichitahouseholdservices.com

WICHITA BEST CLEANING SERVICES
(316) 500-7551
wichitabestcleaningservices.com

A1 CLEANING OF WICHITA
(316) 500-7551
a1cleaningofwichita.com

PRICE CLEANING SERVICES OF WICHITA
(316) 500-7551
cleaningcompanywichita.com

UNO CLEANING WICHITA
(316) 500-7551
unocleaningwichita.com

MAID SERVICES OF WICHITA
(316) 500-7551
maidservicesofwichita.com

HOUSEKEEPING SERVICES OF WICHITA
(316) 500-7551
housekeepingservicesofwichita.com

CLEANING SERVICES OF WICHITA
(316) 500-7551
cleaningservicesofwichita.com

OFFICE CLEANING SERVICES OF WICHITA
(316) 500-7551
officecleanerswichita.com

WICHITA COMMERCIAL CLEANING
(316) 500-7551
commercialcleaningwichita.org

JANITORIAL SERVICES OF WICHITA
(316) 500-7551
janitorialservicesofwichita.com

Service Area

55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS
Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS
Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS
Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS
Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS
Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS
Winfield, KS | Yoder, KS

ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven

BEST CLEANING SERVICE FOR PET OWNERS IN WICHITA KS

WICHITA CLEANING COMPANY

REQUEST MORE INFORMATION. CONTACT US